GenomeNet

>syc:syc1787_c K02112 F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1] | (GenBank) atpB; ATP synthase beta subunit (A)
MVTTTEKTNIGYIRQVIGPVVDVEFPAGKLPQIYNALVIKGKNEAGQDLSVTCEVQQLLG
DRKVRAVSMSTTDGLVRGLEVIDTGAPISVPVGEATLGRIFNVLGEPVDELGPVNAATTS
PIHRDAPKLTDLETKPKVFETGIKVIDLLAPYRQGGKIGLFGGAGVGKTVLIQELINNIA
KEHGGVSVFGGVGERTREGNDLYQEFKESGVIDEKNIANSKVALVYGQMNEPPGARMRVG
LSALTMAEHFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGQLQ
ERITSTLEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLASKGIYPAVDPLDS
TSTMLQPSIVGEEHYRTARAVQSTLQRYKELQDIIAILGLDELSEEDRQTVARARKIEKF
LSQPFFVAEVFTGSPGKYVKLEDTISGFNRILNGELDDLPEQAFYLVGDIQEAIEKGAKL
KAES

BLAST