GenomeNet

>syc:syc1789_d K04077 chaperonin GroEL | (GenBank) groEL1; GroEL protein (A)
MAKRIIYNENARRALEKGIDILAEAVAVTLGPKGRNVVLEKKFGAPQIINDGVTIAKEIE
LEDHIENTGVALIRQAASKTNDAAGDGTTTATVLAHAVVKEGLRNVAAGANAILLKRGID
KATNFLVEQIKSHARPVEDSKSIAQVGAISAGNDFEVGQMIADAMDKVGKEGVISLEEGK
SMTTELEVTEGMRFDKGYISPYFATDTERMEAVFDEPFILITDKKIGLVQDLVPVLEQVA
RAGRPLVIIAEDIEKEALATLVVNRLRGVLNVAAVKAPGFGDRRKAMLEDIAVLTGGQLI
TEDAGLKLDTTKLDQLGKARRITITKDNTTIVAEGNEAAVKARVDQIRRQIEETESSYDK
EKLQERLAKLSGGVAVVKVGAATETEMKDRKLRLEDAINATKAAVEEGIVPGGGTTLAHL
APQLEEWATANLSGEELTGAQIVARALTAPLKRIAENAGLNGAVISERVKELPFDEGYDA
SNNQFVNMFTAGIVDPAKVTRSALQNAASIAAMVLTTECIVVDKPEPKEKAPAGAGGGMG
DFDY

BLAST