GenomeNet

>syc:syc1801_c K02956 small subunit ribosomal protein S15 | (GenBank) rps15; 30S ribosomal protein S15 (A)
MLLSEFAEARLSSMSLTQARKQEIFEAYQIHPTDTGSADVQVAVLSERISRLSQHLQQNK
KDFASRTGLLRLIGQRKRLLAYILKQDRDRYKALIERLGIRG

BLAST