GenomeNet

>syc:syc1807_c no KO assigned | (GenBank) unknown protein (A)
MTVRSRFLQKTWQRYREPIVMITIALGFLGCMGLRIQWDFAEHQARLQALQAQGALPLAT
PDSQTTPNRTVEAAIRYAIDQNLIPNGDNDCLTGEYRYQLARYGLRVDCRGESEPEWQGY
GIIPPPPEAAMRQPLPAAQSGLLSAPAAQ

BLAST