GenomeNet

>syc:syc1810_d K00979 3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase) [EC:2.7.7.38] | (GenBank) hypothetical protein (A)
MVRILAVIPARYASERLPGKVLLPIAGRPMLQWVYEATIASNVFDQVAIATEDPRVVEAA
AAFGAEAILTSADLASGTDRVAEASLHFPDCKVIANVQGDQPFVTPGLLQALVSPYRAGE
LPEMTTVGGPYDPAQDADDPNTVKVVCDQRGNALYFSRSAIPYPRTVVHDLPVYHHFGLY
AFRRDFLAQYRQLPPTPLERCESLEQLRVLEQGYRIRVVPCADKVIEVNTADDLERANAW
ASQR

BLAST