GenomeNet

>syc:syc1819_c no KO assigned | (GenBank) hypothetical protein (A)
MAQTTSTAVFWGVICCFLPSSRECQPQALSLVPVPILAIAPPPPSPMRPAPIPPASEPLQ
YRAIGLVRGRYQPDPEVFTKGTLIANDGVSLDAVLLGRVLSLVKKHIDLSQEHLWVVYPR
TRDREGGLHMQIVGLWEPEMLTKRSQLTPGIRPPSPPKLQVSENFFSIRGEVVFTRPDLQ
RIVVRISQQAKTEPGERPAGFKLVLKGNLDLRALHHFWDFQVERQGEVLVVRQAEAVAAL
PGRRPKPKPQLRGQGQSSEHRSASYAAQAGEVRPQRSPLPRRVDQRDRPRPQPSGQKAPR
PIKSVRLPSADAGSPEEA

BLAST