GenomeNet

>syc:syc1828_d K01515 ADP-ribose pyrophosphatase [EC:3.6.1.13] | (GenBank) hypothetical protein (A)
MDRTPPEILRQTLSYRSRKFDFEVNQLRLPNQVEGEWACIRHPGGALAVPVLPDGRLVLV
RQYRFAAEGWLLEFPAGTVEDHEDPAATIAREIEEETGYRAGTWQHLGDFFLAPGYSDEV
IYAYLATDLEKLEHPPAGDEDEDIEVLALTPEELIAAIRDGEPVDAKTVTAFWLYQQLNS
AEL

BLAST