GenomeNet

>syc:syc1841_d no KO assigned | (GenBank) hypothetical protein (A)
MSVWSRSQLSPPIPLCAMILPGAVVRVTNPSDIYYGYQGYVQRLSRGKVAVLFEGGNWDK
LVTFRLSEVAPA

BLAST