GenomeNet

>syc:syc1844_d no KO assigned | (GenBank) hypothetical protein (A)
MRRLLPRCFSVLALSLLSSLTASIAIAQTIPIQSPVRRLEGQFNTTPVPHSNQPEIVQSE
GILIDTGPGFVRVTGSDLNRVPPHLQTIANPTYAFNGPFGLHLHHVYRPSDTTKFGGTRD
RGLLYVGVIATNFSDRPVRLGFQEGSLNTSFESPFFTQTLGVFSNSRWNYKSGPGDAAAL
SLLTGKRDWRLPAGLVLPPRSRSLLFSLPIAARGSATVLARGVSDGPVHLAVVATDHNPD
PDAFFSVLDRRLLAEGRTYLADLLRIQQRQVFSRVGGVAQGDRYEANLEADLQQPLHVPL
TTTWRKHFGTQELQANSLLTRMPDSALENIGTYGVEYVLNFRLRGQGLQRLLFSTLPEPK
DFLAFRGTLRIDFQGQTDYVHLSQRSGSTDTLYQFQMPPSGQADLRVSLVYPPDSTPGHL
LSIVPEVEYARLLPSPLPISPALSSQRLLSFP

BLAST