GenomeNet

>syc:syc1845_d no KO assigned | (GenBank) hypothetical protein (A)
MQLTKGFEVEVYTGTPSGQVVGLSDRICSDLQGFMREPDSRNVEYTTPPRPCYDRLLLDL
LEPRRRLRAYLQQQGGYTLIPGSTLALSGGDHFYRSDPTNPYHDFIERSYGTTVVTASIH
INIGLSDPETILKACRLVRLEAPLYLALSASSPFLDGQVTGSHSTRWQLFPKTPPEVPLF
ESHAHFIRWTEAQLAAGSMQNVRHLWSSVRPNGDRHPYKINRLELRICDLVANPLDLLAI
TALLEARLQQLLEQPQLDPLIASRLTPDELVQLSDANEVAAARHSLDADLQHWQDGRTIA
ARDWIETLYETVFPLAKTRGYSCFLLPIQRLLQDGNLAQQWLRQVAAGATPEAAMVQAIA
ATAAEEQELADKLYGVAC

BLAST