GenomeNet

>syc:syc1850_d K03530 DNA-binding protein HU-beta | (GenBank) himA; DNA binding protein HU (A)
MNKGELIDQVAVRTGLTKVQVAAAIDALVDVIVDTVVEGEKVSILGFGAFEARERSERQG
LNPKTGDKILIPAKKVPAFTAGKLFKDRVQG

BLAST