GenomeNet

>syc:syc1851_c K03555 DNA mismatch repair protein MutS | (GenBank) mutS; DNA mismatch repair protein MutS (A)
MTTSELPEHLAKHEVRYADHRQVERDRLTPMMQHYAEVKDQHLQQILLYRMGDFFECFFQ
DAIVVARELELVLTSKEAGKEVGRVPMAGIPYHALDRYASQLVEKGYAIAICDQVETAAQ
AQGPLVRREITRIITPGTILEEGMLQARRNNFLAAVVIAGEHWGLAYADSSTGDYWTSQS
TGLEGLTQELYRLQPSEVLFPSAAPDLAGLLRPGQSKPQQIPDCLPDSFCYALRSPMPFE
LHEARQRLLEHFQLRSLEGCGCEQLPLAIRAAGGLLDYLGETQRESLAPLQKPRTYSLSE
FLILDQQTRRNLEITQTQRDGSFHGSLLWALDRTMTSMGGRLLRRWLLQPLLNPEAIRNR
QAAIQELCQDGRLRQDLRSLLQKIYDLERLSGRAGAGTANARDLLALAESLLRLPELAQL
LSRAQSPLLAQLQQVPPELEQLGDRLQQHLVESPPLQLTEGGLIRSGVAIALDELRQQVE
SDRQWIASLEASERTATGINSLKVGYSKTFGYFISLSRSKADQVPDHYIRRQTLTNEERF
ITPDLKERESRILNAQTDLNQLEYDLFVGLRSEVSHHVETIRAIATAVAAADVLAALAEV
AVYQNYCCPEIRDDRQLAIQDGRHPVVEQALPSGFYVPNSCGLGSDRGPDLIVLTGPNAS
GKSCYLRQVGLIQLLAQIGSFVPAKNAQVGICDRIFTRVGAVDDLATGQSTFMVEMDETA
NILNHATARSLVLLDEIGRGTATFDGLSIAWAVAEYLAREIQARTIFATHYHELNELSGL
LKNVANFQVTVKELPDRIVFLHQVQPGGADRSYGIEAARLAGLPSEVIDRAREVMSRIEK
HSRIAVGLRRGNGSQRRTQASPQQIDATIATEQLGLFSGPSH

BLAST