GenomeNet

>syc:syc1854_d K00794 6,7-dimethyl-8-ribityllumazine synthase [EC:2.5.1.78] | (GenBank) ribH; riboflavin synthase beta subunit (A)
MAVFEGSFVNASQFRLAVVIGRFNDLVCEKLLAGCQDCLKRHGVDPDPQGTQVDYAWVPG
SFEIPLVARQLALTGRYDAIICLGAVIRGQTPHFDYVASEVAKGVAATSLQTGIPIAFGV
LTVDNLQQALERAGIKSNLGWNYALSALEMASLMHQIRSTTGEVPRQTLPLAAAPSNFAG
T

BLAST