GenomeNet

>syc:syc1856_d no KO assigned | (GenBank) two-component sensor histidine kinase (A)
MASGWTLLAGFAGGLTIASLFQSIRDLSQPGIKETSTEAATGPELPRTPAALPDNELKQR
LLNSELQAALAQFQAGYLARAAHELRSPLSTLMSLNQLILADLCESPAEERVAVQRSQIA
ARRLLQLLDQLIVVSQWQSGRLPLRFEDLAIAPVLTRLQTVLQPIAAGRNLALHWPTDWS
TLPMVNSDRRALEHCLLHWLQAAIAAPGCTQIQLRIRAEQSDWWVEIDHDGPAWTDVANL
EQSLQGQGLSILIGQQLLDLLGGQLEFSTPESGSARLSLRLLGRLVPAIAASRGAPLLVA
QQTVAAADQQQEEGAVGHDPNAGYQQTPDE

BLAST