GenomeNet

>syc:syc1857_c no KO assigned | (GenBank) hypothetical protein (A)
MKRSLSLSLITLVATGSALLGGCTETSSSPASAPSVVPEAAANQAAEAPRANAPRPQLAK
TATMQLAVQDVPTAVRSAQAIVNREQGDILQQTESSGDSPSATLQARIPADRLETAIAAF
RALGRVDTVNVQAEDVARQLTDLQARLTNLERTERALQSILDRATKVEDVLKVTERLSST
REQIEQLKAEQLNLRTRVAYSTITLQFQSQILGETALPAFAPELETAWRQSSQSVLLLIR
SLLVAGVWIVAYSPLFLLLIGGGYGLLRYQQRSTTTSSDRRDQPPQQPQA

BLAST