GenomeNet

>syc:syc1860_d no KO assigned | (GenBank) glcP; glucose transport protein (A)
MVVSSHSAMSSSIAKSVQSHIDETPPRPLSSMQWQIWSLAAMGKLFEGMVIFITGVAVPL
IERDFNLSSALKGSVAAASLLGILIGASLFGNLADRYGRKFVFVIEMAIFTIAIALSAVA
WNVSALIFFLFCSGLALGADYPIAHIIVSESIPSRFRGRMVLGAFAFQSVGSLAGVLIGL
LVLRIYPEVGAWHWMYAALVIPSILVFLMRTKLPESPHWLVSRKQFELAHRAAKALLQRP
VAIAQNDSDGERQNPRLGYRRLLTPRYLRATVLTAVPWFLQDLATYGIGIFTPTILATLF
TKAQPNFVLQDMIATEGSGLIDLFLLVGFAASIPLVDKFGRIPLQIIGFIGCSVGLIIAS
LSAVSIPESHELRILFIFGGFILFNFMTNLGPNAMTYVLSGEVFPTEIRGVGAGFAASFA
KIGAVATAFFFPILREQIGTVALLCGLAVTSLLGALVTFLFRIEPNGHSLEELSEKPLV

BLAST