GenomeNet

>syc:syc1871_d K02982 small subunit ribosomal protein S3 | (GenBank) rps3; 30S ribosomal protein S3 (A)
MGQKINPVGFRLGVTQEHRSRWFADPNRYPQLLQEDKKIRDYVRKNLSNAGIADIRVERK
ADQVELEIRTARPGVVVGRGGAGIDTLREGLQALLKDSSRQIRINVIEVERVDADAALLG
EYIAQQLERRVAFRRCVRQAIQRAQRAGVQGIKIQVAGRLNGAEIARTEWTREGRVPLHT
LRADIDYAYTTATTTYGILGIKVWVFRGEIIPGQEDAAPSNVGQPRRRNQQRRRQQFEDR
SNEG

BLAST