GenomeNet

>syc:syc1880_d K02881 large subunit ribosomal protein L18 | (GenBank) rpl18; 50S ribosomal protein L18 (A)
MKVSRRESTRRRHRRVRRTIVGTPARPRLSVFRSNNHIYAQVIDDAAGHTLAAASSLDPD
LRQSLTSGGNQQASAAVGKLIAERAQAKGVTTVVFDRGGNLYHGRVKALAEAAREAGLEF

BLAST