GenomeNet

>syc:syc1907_c K07305 peptide-methionine (R)-S-oxide reductase [EC:1.8.4.12] | (GenBank) hypothetical protein (A)
MTEKIRKSEEEWRAQLTPEQFQVTRKHGTERAFTGAYWDTKDPGLYRCICCDAPLFRSDT
KFDSGTGWPSFWAPVDESAITYKKDFSFLMMRTEILCARCDAHLGHVFPDGPKPTGQRYC
LNSASLKLDTETPASPSSEA

BLAST