GenomeNet

>syc:syc1946_d K12251 N-carbamoylputrescine amidase [EC:3.5.1.53] | (GenBank) hypothetical protein (A)
MIDRDRVTAAIREAAAAGAELIVLPEIHGGYYFCQTEDPAQFDRAESIPGPSTDYYSAIA
RELSVVLILSLFERRAAGLYHNTAVVIERDGTIAGRYRKMHIPDDPAYYEKFYFTPGDLG
FEPIQTSVGKLGVLVCWDQWYPEAARLMALAGAELLIYPTAIGWDPQDVPEEQQRQLEAW
QTVQRGHAIANGIPVLSVNRVGFEPSPDPAAAGSQFWGSSFIAGPQGEWLAKAGDREPEL
LIADLDRDRSEQVRRIWPFLRDRRIDAYGDLVRRYRD

BLAST