GenomeNet

>syn:sll0086 K01551 arsenite/tail-anchored protein-transporting ATPase [EC:7.3.2.7 7.3.-.-] | (GenBank) hypothetical protein (A)
MRVILMTGKGGVGKTSVAAATGLRCAELGHKTLVLSTDPAHSLADSFDLELGHEPRLVKE
NLWGAELDALMELEGNWGAVKRYITQVLQARGLDGVQAEELAILPGMDEIFGLVRMKRHY
DEADYDVLIIDSAPTGTALRLLSLPEVGGWYMRRFYKPLQGMSVALRPLVEPLFRPIAGF
SLPDKEVMDAPYEFYEQIEALEKVLTDNTQTSVRLVTNPEKMVLKESLRAHAYLSLYNVS
TDLVIANRILPETIDDPFFQRWKSNQQVYKQEIYDNFHPLPVKEAPLFSEEMCGLAALER
LKDTLYKDEDPSQVYYKENTINIVQGSNNDYSLELYLPGIPKEQIQLNKTGDELNVRIGN
HRRNLVLPQALAALSPAGAKMEDDYLKIRFAEAVKR

BLAST