GenomeNet

>syn:sll0369 no KO assigned | (GenBank) unknown protein (A)
MQNFFVIGFQSCLRLFGAFWIFGGFLTLQAARESLFLDRAIEAIALKKQDKLLSYFLFLG
SIFTLATGITLVLASRWVFLPLTLSIVSQIVYFSVQKRRFSRAKTEEEREDAQVQPTTIN
AFKTSCVVAIACALGWAVGAIK

BLAST