GenomeNet

>syn:sll0467 K07568 S-adenosylmethionine:tRNA ribosyltransferase-isomerase [EC:2.4.99.17] | (GenBank) queA; queuosine biosynthesis protein; QueA (A)
MDQDKYLSSYDYHLPADCIAQTPAVPRDHSRLLVVKDPFTVDHQHFYDLGNYLKPGDLLV
LNDTKVMPARLHGQKENGVAVEILLLTECTENQWIALVKPGKRLKLGAKVKFPARDGEKP
DLWATILQRDDATGGRLLEFVLEPGQRLWDVLPDYGEIPFPPYIGDRQATNDQYQTIYAE
KLGAVAAPTAGLHFTEELFTKLAQQGVQTAKVTLHVGIGTFRPVEAENILDHVMHQEWID
VPPTTVEVIEKTRASGGRIFAVGTTVVRCLEGMAQESDFPRQPLQPFRGQTDLFIYPGYQ
WRLVDGLITNFHLPKSSLLMLVSALISRPRLMAIYETAIAKGYRFYSFGDAMVILPEACR
GQEKIR

BLAST