GenomeNet

>syn:sll0477 no KO assigned | (GenBank) unknown protein (A)
MLDNCKRLLFRKFPCFLSMAPSPLFLTQTPRLLDEFLKGGVVMFPLLLLSILALTTAFER
GWFWSRLLIQEDQVVRDVLDAAVEDLVKAREIAEHARHLAIGRFLLAPLKLRHPSPETFR
LAMEATADKEFARMRRGDKLLETIIALAPLLGLLGTVTGLIRTFNNLNIGGGGSSAEATQ
AASGIGEALITTAAGMMVAIFALLVFRVLVSLQSQQMDYFAAVGSELELIYREVWYEPHQ
PMPNLLMAARIAEP

BLAST