GenomeNet

>syn:sll0584 no KO assigned | (GenBank) ycf36; hypothetical protein (A)
MKPMRESSPQICPVPIDQQPVNEYEALKSAWLYSWGQVDLLSYGKNLTRLALLISFIVSP
IASASFSVEKQPVQCGFLIVLGICLLLSLFVLRLMLGWRYVGDRLGAETVTYEESGWYDG
QVWRKPLEVQTRDQLILRYQVNPVLQRWQNTLKLLGATMAIDILIWTIFRFLH

BLAST