GenomeNet

>syn:sll0585 K01424 L-asparaginase [EC:3.5.1.1] | (GenBank) hypothetical protein (A)
MPRIEDRLINRTPRNFTIIGNSPNSMSRGKRPHTTPIEVHLLREGIIESQHWAEATVYDD
RGRVLMLAGDSTSNAFIRSSLKPFQALAVTSTGTMERYGLTDKDLAIMCGSHQGTIEQAR
QVFNILWRADIEPQALQCPIPAGQESPLYHGCSGKHAGMLAVCQQQDWPLHSYLQQNSPI
QKLILSKVADLLGMPGAELIAAHDDCGAPTYTMELGQIAHLYALLASGQQLGLERVARAM
TYYPYFVAGEGCFDTELMQQMEGELVSKSGAEGVQCVGRVGEGLGLAIKVKDGSKRAKYA
VAIHLLQQMGWIPPQVAETLSEKFVRLGKYKRLEVIGELAML

BLAST