GenomeNet

>syn:sll0594 no KO assigned | (GenBank) transcriptional regulatory protein (A)
MFVNSSPIADGLSALVGLDSQPLQFYERGDVVPPKDQGCWQIYRGILQVSQWTLGGDEVL
MGWAQPGSFVGLDFSAHQRETYQIRALTDVYLRGYSLEMITNNANLCRLVLDQTLQQVRQ
REALLAIAGYKRVDERLQGLLNLLGQELGQPGTGGMRLSVRLTHQMLANAIGTTRVTVTR
LLGEFQTQGKVSLDGDRHLVIALGN

BLAST