GenomeNet

>syn:sll0825 K00974 tRNA nucleotidyltransferase (CCA-adding enzyme) [EC:2.7.7.72 3.1.3.- 3.1.4.-] | (GenBank) pcnB; polyA polymerase (A)
MLCPVSHLADLRQQVPFDLALLPPQACLVGGAVRDALLGRRREYLDWDFVVPSGAIETAS
AIASRYRAGFVVLDKARHIARVVFAHGTVDFAQQEGMSLEQDLARRDFTVNAIAYNFQQN
KLIDPMAGVGDLQRGQLKMVAAVNLADDPLRLLRAYRQAAQLQFTLDPDTRTVLRELAPR
IKTVAAERVQAEFNYLLGSPRGSQWLLAAWQDGILAHWFSHANLSSLNAIGCIDLAIAAI
KNQLTLVERQQFFQALGKKGIAIAKLASLVCADVKIAEGELQRLKYSRHELRSVQAILQG
YPQLSCLENSPTVRQLYFFFVELGKYLPHFVLYALAHCPHNYHSFIFELLTHYLNSGDRL
AHPQPLITGKDLIDKLHIKPSPLIGQLLTEINIAHIEGKISNEQEALAYAQELGKS

BLAST