GenomeNet

>syn:sll1131 no KO assigned | (GenBank) unknown protein (A)
MITRETLPVYLQRLWQNAMVRWWIIGIIAMVLNVVLLDWFKVSLGMGLTWASVLSAEVIT
IIRYGAIDLWVFRNPNLSWQRCWEYHVANFSGFFLWSLIIVILGNKLGWDHKIAAIVATM
ITVFWSMATNFLWVWRKPKKKA

BLAST