GenomeNet

>syn:sll1138 K01838 beta-phosphoglucomutase [EC:5.4.2.6] | (GenBank) unknown protein (A)
MLKAVLLDFNGVVINDEAIHRSLIDELLLTENLRPLTPAEYQQFCLGRSDRACLVDLFEH
RGRGLTEAYLQKLIDRKAESYHQKLVALETLPIYGGLKEFLEKLQLRRLAIALVTGAVRS
EVEYGLDRAGLARYFPVIVAGDDIASSKPQPDGYQLAIHKLNQWRQSQAVTDSLLDDIAP
LLPENCLAIEDTFAGIEAAKKAGMAVVGIAHTYPYHFMQRQANWAVDRFDELDLDRLQVI
FSRPKLAV

BLAST