GenomeNet

>syn:sll1142 K08999 uncharacterized protein | (GenBank) hypothetical protein (A)
MIEMRVAGIALDAVSRSPIVLLKDGSERRALPIYISQDQARSIIGALENQKPTRPLTHDL
MVNLLTTWDVDLKKIIIHSLQDNTFYAVLCCAQGDQIREIDCRPSDAISLALRMDSPIWV
MEEVLADASIPVDRDADEEERQAFRDFLDNVSPETLIKQARLSSDSFEAESDS

BLAST