GenomeNet

>syn:sll1280 no KO assigned | (GenBank) hypothetical protein (A)
MKLGRILKMSEFMSNSIPLVGLKADHFRHPLDQMATTNLKQIPGLDLMVRGLLGSVAEQF
FALNNLAASVRVGEKQLPHLHQLLLDACKILDLEAPELYIQQNPQPNAYTFAMRGKKPFM
VMHTSLVDMLTPAEIQAVMAHELGHLKCEHGVYLTLANIMVLAAGLIPNWGAVLTQSLQS
QMLEWVRCAEFSCDRAALLAVQDPKVVMSVLMKLAGGSPQLAPLLNLDAFIDQAREYDRL
GEDEMGAMLRNMQTQNLTHPVPVLRAREIDRWSDSQTYQNLLKGRKNAYNLNTEENKGGW
RNW

BLAST