GenomeNet

>syn:sll1281 K02724 photosystem II PsbZ protein | (GenBank) ycf9; ycf9 gene product (A)
MCFPQGTYFGSLLRERFNDNICPYQRLSRISAGDSLAQFIRRNSKMSIVFQIALAALVLF
SFVMVVGVPVAYASPQNWDRSKPLLYLGSGIWAILVIVVALLNFLVV

BLAST