GenomeNet

>syn:sll1348 K18979 epoxyqueuosine reductase [EC:1.17.99.6] | (GenBank) hypothetical protein (A)
MGIAPVSETENDEAAQRLQSWIALGYNADMAWMANPKRQNIRELLPSARSVIAVGLNYYT
PHQRSGDPAHGKISRYAWGRDYHRVLTKKLKALNLWLEQQVPDLQSRYYVDTGPIQEKAW
AERAGLGWVGKNGNLISRDYGSWLFLGEIVTNITLQGDRPHSQHCGTCTRCLEACPTQAI
VEPFVVDSNKCIAYHTIENRAEILPTAIADNLQGWVAGCDICQDVCPWNQRFAQPTDVAD
FDPYEGNLNPELETLANITEADWQQQFTASALRRIKPAMLRRNAQANLQ

BLAST