GenomeNet

>syn:sll1352 no KO assigned | (GenBank) unknown protein (A)
MEVSQSKPEGFLPPRSLLVGMAIGAVILFICATVRHWLFQSTALDLGFFDQAIYLISQGE
YPRVSFRGFHILGDHAAFLVYPIAIFYKIYPSVYWLFLIQAIALALGAWPTWQLAKQTGL
GEKESLTMALVYGLYPLIFNINLFDFHTEVIAVPALLWAVWSARANKWGIFLISLVTILA
SKAVLSLTVFMLGIWLLIWERKRLMGLITTVAGIAWFIITTKGIIPAFSGEEAAAVGRYS
FLGDSVAEIILNLILKPQIVLGMLFTLDNLFYLVLLTAPVIWGIWGKAWAMFIPAIPALF
VNLVTDYLPQKDLIHQYSLPILPFLLLVVMTHWYQGSSWLKKLRWIILWTAIAFLALGKY
TYFFGRYWHHWGQLANLQTAVSLVQPGDRVLTSPHLAAHLSHRPDLELAIEAEAPFDLNR
FDAVLLQTNYAGWENSQGTVEALAQRVSQDSAFTPEYQENEVILYRRAPSIP

BLAST