GenomeNet

>syn:sll1353 no KO assigned | (GenBank) sensory transduction histidine kinase (A)
MGKFLDLLQKYWLLPCLLLAGYGGNYFKLHIFFGVDFLFGSIATLLVLVCYSLPWGLVSA
AIAGSHTLIIWRHGYGILIIILEALVVGLMLRRRQTNLVLINSLFWLLIGIPLVYIFYRW
GLNMTSVTTSLITLKQATNGIFNSLIASFLITGFGLSKQKFSPSTNPAFFPWKKLSFEQT
LFNLLVAFVFFPLFFITVVNGQEAFVQMEKQTVQELTALSIPIQNSVEDWYQSHLEGAEV
FATEILPLVAAINQGNGAQLPALSLMTHTIQTAFTGFSNIYVGDRQGQIIASSPEFNEVG
ESRLGLIQAEKIAGFSIPSQIQVSPLHRTNVNVDPHVAITIPLVANNSFEGFINASLNLA
KMKDLLYANRVSKELNITLINGQNQVVASTIANVLPLEIYQPFEGGDPRDLGSSNYHWYP
DTPANPTIRWRDSYYYHILPLDKINDWQLVLGLPARESIEKLQAQSVQKLGLLLFLSLVG
LVVAIGVSKRVANPLLTLAKITTDIPTKMQYQGLTPIALRSEVSEVITLNENFNEMLITL
QNQFKIIKQAKDNLEMRVAERTHTLIVINKQLAGEIEERQRIEIKLREAKESAELANRVK
SEFLANISHEIRTPMNAILGFCDLLLQKDLSLSQTKKYLNAIGSSSKILLALIDDILDIS
KIEAGKLVIHLEPVDLRVIIREIKQIFDYKAESKSLLLTIQIDETLNQAIYFDAVRLRQI
LFNLVGNALKFTEEGQVFIYIGVEGIQVRSQGTYISLAIEVTDTGIGIAPEDQAKIFDVF
TQSQGQSTRKYGGTGLGLTITRRLTALLGGEISLSSRLGEGSTFILHFPAVRLVENSLKS
DLTNGDGGNLTDRLGSMSSSSANTTEKLLPTRVGNMAPDNNSLGNHNGPSQGFPRAVPLI
DQAQRQQLISLLEQEETNVWNKLRHTLISRQIRNFGDRLSSWGNEYGWEDLHTYGQSIIK
ALENFDSRRLEQLMGQFPQYRASLTEVSAGVDGKHASE

BLAST