GenomeNet

>syn:sll1452 K15578 nitrate/nitrite transport system ATP-binding protein [EC:3.6.3.-] | (GenBank) nrtC; nitrate transport protein; NrtC (A)
MMPFIEIDHVDRIFPLPDGGRYIALKNIELKISQGEFISLIGHSGCGKSTLLNMISGLDK
PTFGGVIMEGKEITEPGPERMVVFQNYSLLPWLTVRQNIALAVNRVLRDLPKPEQEKIID
DNIALVGLQRAAHKRPGELSGGMKQRVAIARALSTRPKVLLLDEPFGALDALTRGNLQER
LMEIVQESGVTCIMVTHDVDEALLLSDRVVMLTTGPEAHIGQILEVPIPRPRHRLEVVNH
PSYYALRGEMVYFLNQQKRAKKVGAVSQFAEAMGGNGLEKINLDLGFIPLTDCAPLVVAK
EKGFFQKHGLEQVNLVKEPSWQAIADGIRERRLDGAQMVAGMPLALTLGMGGKTPLPMVT
AMVMSRNGNAITLSKKFAEAGVKTLEDLRLKLAETPDQVSTLGMVHPASMQNLLLRYWLA
SGSIDPDQDINLMRLPPPQMVSNLEAGNIDGFCVGEPWNSYAVKQNLGYVIATDLDIWNG
HPEKVLGMREEWVNKYPATHLALVKALLEACEYCDDRRHRQEILDYLALPQYVGTSTEYI
SPGFLTEYDQGNDAEAEMLLDFNQFYVKQSNYPSRSEGLWILTQLARWGYIDFPKNWVEI
IERVRRPDLFGEACRHLGWPDLEGDHHNVSLFDGMVFTPNDPLGYIKRFTIHRDIQVTEI
LIDQIDQVNQ

BLAST