GenomeNet

>syn:sll1464 K08997 serine/tyrosine/threonine adenylyltransferase [EC:2.7.7.-] | (GenBank) hypothetical protein (A)
MTNPFLNLTYEPALESLGNEFFDPVSAATFPEHKLRFRNDRLLPMLGLEPSQVKDDNFVE
AFGLFHGVRPFLALRYHGYQFGEYNPNLGDGRGFLYGQVRGVNGELFDFGTKGSGQTPYS
RGGDGRLTLKGGVREVLAAEALHRLGVKTSRCLSLVETGDSLWRGDEPSPTRASVMIRFS
RSHIRFGTFERLHYHHQTEQIAQLLDHVIVTYYPEVSGSNSDDSAHIAFFRVLVERVAKL
VAQWMAAGFCHGVLNTDNMSITGESFDYGPYGFVPTYDLNFIAAYFDYGGRYRFGNQPAV
CRWNLERLQVSLSSVIPSKAMTEALEDYEKIYLGYYITLIARRLGISSTLGDRLDPELWE
KLVGQTLQCLAQSQWSYPDFFAQLRLNFSPSWRDNADLILENVDLLGADWSTWRSIYQQV
LKQLPPESLAAVPTVLEQANPLTDLLRPRIETVWQAIAEDDNWQPFNDLVQKLQSGN

BLAST