GenomeNet

>syn:sll1715 K07065 uncharacterized protein | (GenBank) unknown protein (A)
MNLIGQRKLINICMGKLFLTMTEVFLDTSFAIALSSITDQNHVRAIQLANQIEANKIRLV
TTQGILLEIGNALSKQRYRKAAIQLLESLETDPSVEVVLLTNSLYKSAFNLFKQREDKEW
GLVDCISFIVMQDRGITDVLTADIHFQQAGFRALLRD

BLAST