GenomeNet

>syn:sll1768 K02033 peptide/nickel transport system permease protein | (GenBank) OppB in a binding protein-dependent transport system (A)
MPMSPLPPAVGLICKRLAIAVITLLGISLVIFSLLALAPGNPLGELATNPSISQEVRDNL
RRSLGLDQALPIRYLKWLWSLLQGDLGYSFTSRSPVIDLIGQRLPTTLWLMGTAYLISLA
IAIPLGVTAALYRGRWWEPLISGISLMGFSLPTFLTGLLFILIFSVQLRWLPFIYDSTLT
VDSMASLGTQIRQLLMPVGVLVFYQSAVILRFVRSAALEELPQNYIRTAYAKGLGTWGML
KNHLLKNASLPLITLIALDVPTIFTGALVTEQVFRVPGIGALLIESIYRSDTPVVMAVTF
LYAVLIVFFSSLADLIYQLVDPRIRW

BLAST