GenomeNet

>syn:sll1771 K20074 PPM family protein phosphatase [EC:3.1.3.16] | (GenBank) hypothetical protein (A)
MTEVNLSVVSCSSTGKTDPGLVRQYNQDSFYLDPEGRFYIVADGMGGHAGGEEASRIAVE
RVRDYLDTYWQSEITSEQLLRDALMDANEGILEDQKINLERRDMGTTAVLIAFREDGAWR
AHVGDSRLYRLRNQQLERVTEDHTWVARALKMGDIDPAQAKVHPWRHVLFQCLGRQDLNF
IEVEALDAQPGDTFMMCSDGLTEEVPDNLIEKILTGQGNCDDQAVQLIEEAKNAGGSDNI
TIVLVDFSEDNQDS

BLAST