GenomeNet

>syn:sll2013 no KO assigned | (GenBank) hypothetical protein (A)
MRVTFSATEQLQLRQSEPLPSLQHYLRQPQRLVQAIADPKLMEVLPGDQFRLKMRPLNFL
DIYHFQPTVVLKVWANATGTVFLESESCEIRGIDYINHRFSLQLKGRLAPYCQDGHTLLQ
GKADLQVGVDLPQALWLTPKPLLEMAANGLLRGVLARIKQRLQGQLLADYQQWLAQQNDN
LVTQASPTAEALEAI

BLAST