GenomeNet

>syn:slr0073 no KO assigned | (GenBank) sensory transduction histidine kinase (A)
MLGEWPSKFEGTTLDQQKILGYFIEEAQEHLETLERGILDLGKVVQDSEQVNEMFRAAHS
IKGGAAMLGYTSIQKTAHRLEDAFKVLKEHQLPVDQKLESLFLNGYDVLQDLVEKLQSPA
GLQPEEADSIVDGAAYQFEELQNYLNYLLNQGSATATSTQTMAAKSTSTGTFNESDVPEE
IKVLLHKMLQLFKQEPSATSREKLQEYCTRLGRLAPKQENWQHLLSLSKQAIANPLHSYR
TLAPVVLKDLKQGYDCFVLAKPGNIRVSDGLKQLASSQVAQVLIPADPAAAASVLMKVFN
DSQLRQLIKNLSAAR

BLAST