GenomeNet

>syn:slr0079 no KO assigned | (GenBank) gspE; general secretion pathway protein E (A)
MVFSSDSPEFSLSPFEQALIEAGYLSLSQIHQALMEARRTGIALPTLVETILGESLPDEL
HRQYQAQQRFALSVIHGVKFFDQHQLTTLANTEAIASLLNRYFPLPICRQYGFLPLHYRE
NPGALLVVMVDPSDPEASQFLQRQLAPHRLTLRRRGVTKDDFDNLIDQLYHDPEVQAALN
AHRQTEISEDPYDGKATVVEVTEIIEDLPQQIAALQNTPPVAPPPVSAIAENTNDSNPEA
KSEGPEVKLANKILILGLREGASEIHIDPQDNRVLVQIRQGGNLRMLLEPLPRELGPKLV
ARVKTMAHLDTSQTNIPQKARIRKSYNGQSVFFYVNILPSFYGEKILVRVVPHLEKLPDF
AQLCGDRQSQESLQRLAQESQGLVVVIGAAYGGKTTTMEAFLGQQLDQNRSVALVSDPLV
HVYENINQLEVNPQKDFTSEKAVQSLQDQWPAVMAVDPLEDQETAQILTQVLNQGHLVFT
SVIAKDVPSAIAQLQQWFEPAVLGQHLKGIVSQRPVRRVCPACRLRGEVTPEEQQRFGLP
PGTIYRANSLSMELMAQPMIKSRLCRQCHGLGYSGMTGIFEVVAITPELQQLVSSPCSHA
EIINGLSQAGIASPARQAITLVSQGVTTLEEVTRLFPQLPRQLSPRSSPPEAISAQSSPM
TPPATQTIPGETMFSDDQWWQRLQQLEKSVQELNRALADLKKMAGDRPSAHRTRAGDHHS
PSAAGPNLDLMAELQALEDLSAHKRPKARDRHEQAVTVMEGFDQIEELLIDDQLGQPAAA
PFNAGEETFIAEEEANVPEGKKFNPFKSVIDPW

BLAST