GenomeNet

>syn:slr0092 no KO assigned | (GenBank) hypothetical protein (A)
MADRPQLSIIIPVFNEAKILQKSPTENTRQYLGQFTEDQRIEILIIDGGSQDSTVELCQT
YADSLPLHVFISPQTGRANQMNYGASLSRSEWLLFLHLDSILPHDFFTQIAEILTNSSYI
AGAFGLTIDLPGRPYRWLEKLILWRSIYAQKPYGDQGLFIQRQDFQQLGGFADLPIMEDY
QFMQKLGKQRGKVAIAGGKVITSGRRWQKLGLLRTTAINQLVVAGYHLGVSPQTLVHWYR
GAKPNRGNRPNSDGTSC

BLAST