GenomeNet

>syn:slr0093 K05516 curved DNA-binding protein | (GenBank) dnaJ; DnaJ protein (A)
MASTDFKDYYQILGVTKTASEAEIKKQFRKLALKYHPDKNPGDKAAEEKFKEISEAYEVL
SDPEKRQKYDQFGRYWQQAGTAGQPSGSYGPGVGVDFGGFDFSQYGNFDEFINELLGRFN
TPGGGGQRTSYSYSTGGPGFNDFGGFGNAQAPAGDREATLQLTLAEAFRGVEKRLNLGEE
MVTVRIPAGAKNGSRVRVRGKGMASPYGQRGDLYLNLQLTPHPFFQFEGDNLVCELAIAP
DEAVLGADISVPTPDGMVRMKVPAGVKSGQSLRLKGKGWPNPKQGRGDQLVRLIITAPKN
PSAIERECYEKIQAQRTENPRQAVEKYANLLA

BLAST