GenomeNet

>syn:slr0104 K07037 cyclic-di-AMP phosphodiesterase PgpH [EC:3.1.4.-] | (GenBank) hypothetical protein (A)
MKAIFALRQAVASQLKKSTASSHPLPRTTASTSQDETIWQKIHRSRFVRIAHPPVMLGIT
VVSLTGVVGYRFYNQPQLSVGTESPYTIYAPEDGSFVDERTTEEKRKEVRAGTIPRLQRD
NELTAQLKQERSQYLDAINQLRYLAGTFPYIDTKIFTLEQQHLLRSLGPGEWQQLEDYIS
YGQPLPMASPQLAKLQQLFDQQKATTSPETMAGLLTSIRTAQDRYGRVTARLAEVKADRQ
ITNNQIGALKLDGPTWQTTQQTIIQVHDRILTQGLPAGITAPLLGETVQLHLRNILPPQA
HQVAENSLNNLLKDKYNLTVDKEATKNLAEKAVLAMENVKVSAEKNSVIVRAGEVITQEQ
FVLLDGYGLSQRQVNWQGLLRTAGLVGGALIIFCGVSRRIHRPLRRRDHILLCLLSVSTP
VLFLLDPVYNNLPAISLLTSSFYGPTLAITQVVLVGGLSAFAMESIVWEYLLGSAAAALL
AGMIASKLRSRDELALLGVGVGATQGIVYLFTYLIVNASAVTIIWYTALPSAIVYGLLGL
AWSAMAIGVSPYLERLFDVVTPTRLVELSNPNCPLLQRLAKEAPGTFQHTLFVACLAESA
ARELRCNVELVRTGTLYHDIGKMHDPLGFIENQMGGPNKHDEINDPYVSVDIIKKHVSEG
LVMARRYGLPQVVRDFIPEHQGQMLISYFYIQAKEAAERAGEPPVNEEEFRYTGPIPQSR
ETGIVMLADSCEAALRSLREANPETAMAMVNRIFKARWRDNQLQDSGLKYEELPIIADVF
VRVWQQFHHQRIAYPKAALDVQVTSPSTTRF

BLAST