GenomeNet

>syn:slr0298 no KO assigned | (GenBank) fraH; heterocyst to vegetative cell connection protein (A)
MAVCPTCNHTNPEGAIQCEACFTPLPTLMPCPHCGSSVQSDATFCGNCGQTIDPQQLVVS
APEEEEVPIPIAVAPESAEPIPAIPEVSSTPAPFPVGTQLQSQGASLVHVQTQTTLEIPA
GLTVIHLGKPNDKVPPDIDVSGFANSDVVSRVHADIRLEGNEYFLEDVGSANGTYVNHTA
LLPGNRHLLRPGDRLALGKGDLVTFIFQLH

BLAST