GenomeNet

>syn:slr0513 K02012 iron(III) transport system substrate-binding protein | (GenBank) periplasmic iron-binding protein (A)
MTTKISRRTFFVGGTALTALVVANLPRRASAQSRTINLYSSRHYNTDDALYDAFGEVNLI
EASAEELIERIQSEGANSPGDILFTVDAGMLWRAEQAGLFQPVRSGKLNERIPENLRHPD
GLWYGFTQRARVLYYSRDRVNPADLSTYEALADPQWRGKILVRPSSNVYNLSLTASRIAI
HGEPETRRWLQGLVGNFARQPEGNDTAQIRAIAAGIGDVAIANSYYYIRLQKSTDPADQE
VVEKVSLFFPNTGSGERGTHVNVSGAGVLKNAPNRDAAIAFLEYLASDDAQRYFAEGNNE
YPVIPGVPIDPVLAAHGQLKGDPLNVSNLGRYQPDSARLMNEVGWQ

BLAST