GenomeNet

>syn:slr0516 no KO assigned | (GenBank) hypothetical protein (A)
MNNKKLSLTLPLVGILALTACNQPKEEIDPLSQLREKGECLDCNLAGADLREFNLENARL
NRSDLSGANLSGVNLRRALLDRANLTGANLSETDLTEAALTEANLAGADLSGANLERSFL
RDVDLTGANLKGANLAWANLTAANLTDVDLEEAEFWETTMPDGSRR

BLAST